A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10321 |
Swiss-prot Accession number | Q28365 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
Source organism | Equus asinus (Donkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13721 |
References | 1 PubMed abstract 8672238 2 PubMed abstract 8672238 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | FPDGEFTTQDCPECKLKKNKYFSKLGVPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFIRVTLMGNIRLENHTQCYCSTCYHHKI |
Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
Receptor | Q95179
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10636 |
Swiss-prot Accession number | P19794 (Sequence in FASTA format) |
Description | Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain). |
Source organism | Equus asinus (Donkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 169 Amino acids |
Molecular weight | 17943 |
References | 1 Chopineau M., Combarnous Y., Allen W.R., Stewart F.; Submitted (JUL-1994) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2344391 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCRSMVRVMPAALPPIPQPVCTYRELRFGSIRLPGCPPGVDPMVSFPVALSCHCGPCRLKTTDCGGPRDHPLACAPQTSSSCKDPPSQPLTSTSTPTPGASRRSSHPLPINTS |
Position of mature hormone in Pre-Hormone protein | 149 Residues from position (21-169) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |